KLP Lovasfelszerelés

1118 BUDAPEST, Rétköz utca 51/e. és 6000 KECSKEMÉT, Kisfaludy utca 2/a.
+36 1 309 5112
+36 30 949 7868
Fizetési módok:
  • bankkártya
  • utánvét
  • utalás
Szállítási módok:
  • személyes átvétel
  • futárszolgálat

Forgalmazott márkák

tattinidaslowintecnatowabrad-renswaldhausenloesdaupessoaeltmustadledohit-airbiosaxoneskadronleovetschwenkelfreystiefelmarstallbatesroflexsstars-stripes
Nyeregszekrény Fém (Lapra Szerelt)

Nyeregszekrény Fém (Lapra Szerelt)81 690 Ft

Nyeregszekrény, saját összeszereléssel (lapra szerelt). Könnyen felállítható, szállításhoz csomagolva. Dekoráció nélkül érkezik. Méret: 106 cm x 60 cm x 60 cm Súly: kb. 28,8 kg Figyelmeztetés! A galvanizált fém lapoknak lehetséges, hogy éles a szélük. Ezért kérjük, hogy óvatosan kezelje őket összeszereléskor. RészletekKLP Lovasfelszerelés
Lovacska Plüss Hanggal

Lovacska Plüss Hanggal6 090 Ft

Plüss lovacska színes rajtszámos nyeregalátéttel és kantárral. Ha megnyomja a hasát, csengő és lódobogás hangot ad ki. Elem jár hozzá, nem cserélhető. 3 éves kor fölött ajánlott. Anyaga: 100% poliészter Bélés: 100% poliészter Méret: kb 22 cm magas Figyelem! Nem ajánlott 3 év alatti gyerekek számára, a fulladásveszély miatt! RészletekKLP Lovasfelszerelés
Patrac Gyerek Komplett

Patrac Gyerek Komplett40 830 Ft

Biztos ülés és biztonságos érzés a holnap éllovasainak! Puhán bélelt patrac szép tartozékokkal. Az első és hátsó részek különlegesen magas kivágásúak a biztos ülésért. Csúszásmentes, gumi borítású kapaszkodóval. Lecsatolható panelekkel, amelyek egyszerűen kezelhetők. Tépőzáras térdtámaszokkal és strapabíró nylon szíjakkal készül. Szintetikus borítás,... RészletekKLP Lovasfelszerelés
Kapicán Színes

Kapicán Színes6 500 Ft

Kapicán gurtniból, kiváló ár/érték aránnyal. Könnyű, de strapabíró kapicán, nylonból. Puha béléssel az érzékeny orrnyeregnél. Nélkülözhetetlen a fiatal lovak idomításához és oktatásához, valamint a napi futószáras munkához. A kapicán gyengéd a lovak érzékeny szájához. Puhán bélelt az orron, rögzíteni ugyanúgy kell mint a normál orrszíjat. A karikák... RészletekKLP Lovasfelszerelés
Broncho Plus Folyadék - Köhögés Ellen (1 Liter)

Broncho Plus Folyadék - Köhögés Ellen (1 Liter)10 590 Ft

Ez a termék természetes gyógynövényeket tartalmaz, amelyek pozitív hatásúak a a ló légutaira. Nyugtatólag hat, enyhíti a légzőszervi problémákat, köptető hatású. Mennyiség: 1 liter Összetétel: 1,2-propandiol (E490) 16,00%, glükóz 4,00%, nádmelasz 2,50% Analitikai összetétel: nyers protein 0,00%, nyers rostok 0,00%, olaj és zsír 8,00%, nyers hamu 0,00%, nedvesség... RészletekKLP Lovasfelszerelés
Vödör Összecsukható Új

Vödör Összecsukható Új3 850 Ft

Könnyen használható, vízálló, összecsukható vödör. Ideális utazáshoz. Zsákkal együtt árusítjuk. Méret: 27 x 24 cm Űrtartalom: 11 liter RészletekKLP Lovasfelszerelés
Elektrolit Folyadék (1 Liter)

Elektrolit Folyadék (1 Liter)5 280 Ft

Elektrolit folyadék - helyreállítja a test elektrolit szintjét erős izzadás után. Folyékony táplálék kiegészítő, mellyel kompenzálható az elektrolit veszteség. Magas koncentráció a gyors hatás érdekében. Összetevők: 20% só, 7,5% szódium, 4% glükóz Tartalom: 1 liter RészletekKLP Lovasfelszerelés
Hajháló Gyöngyökkel (3 Db)

Hajháló Gyöngyökkel (3 Db)7 290 Ft

Elegáns hajháló szintetikus gyöngyökkel dekorálva. Visszazárható cipzáras táskában. (1 szett = 3 db) Kontyra való méret. Anyaga: 100% poliészter RészletekKLP Lovasfelszerelés
Heveder Díjlovas Gurtni

Heveder Díjlovas Gurtni5 280 Ft

Díjlovas heveder puha töméssel, pamut borítással és strapabíró nylon szíjakkal. Nem elasztikus. Anyaga: felül - 100% polieszter RészletekKLP Lovasfelszerelés
Hevedertok Báránybőr

Hevedertok Báránybőr20 630 Ft

Hevedertok, mely kivül-belül természetes báránybőrből készült és megakadáyozza a nyomás megmaradó helyét és a kidörzsölődést. Minden valódi és természetes Waldhausen báránybőr termék kiváló minőségű merino gyapjúból készül szakértői kezek között. A valódi báránybőr kiváló tulajdonságokkal rendelkezik, amelyek ideálisak a lovas sporthoz. Például a... RészletekKLP Lovasfelszerelés
Torokszorító Bőr Karórágás Ellen

Torokszorító Bőr Karórágás Ellen11 410 Ft

Bőr torokszorító, karórágás ellen. A tökéletes illeszkedés biztosítja a tökéletes hatást. Kiváló minőságű bőrből, a legfinomabb kidolgozással, lágyan párnázva a toroknál. Egyénileg méretre állítható a két szíjnak köszönhetően. Szín: fekete Méret: közepes RészletekKLP Lovasfelszerelés
Futószárazó Segédszár

Futószárazó Segédszár7 630 Ft

Strapabíró kivitelezés. Gyűrű tartja a kötelet a lábak között. S: 2,70m - 3,20m M: 3,20m - 3,90m L: 3,60m - 4,30m RészletekKLP Lovasfelszerelés
Kulcstartó Nyereg

Kulcstartó Nyereg2 820 Ft

Szilárd fémből, 3D kialakítás mindkét oldalon. Díszdobozban érkezik. RészletekKLP Lovasfelszerelés
Fülsapka Légy Elleni Maszk

Fülsapka Légy Elleni Maszk5 080 Ft

Könnyű légy elleni maszk, mely ideális védelmet biztosít a lovak szemének és füleinek a kellemetlen rovarok ellen. A kis szövésű hálós anyag biztosítja a legmagasabb kényelmet és az akadálymentes kilátást. Fokozatmentesen állítható a tökéletes illeszkedés érdekében. Fülvédővel és elöl nyílással a ló sörényének. RészletekKLP Lovasfelszerelés
Vezetőszár Szivárvány

Vezetőszár Szivárvány3 230 Ft

Rikító neon szivárvány színű vezetőszár, csuklópánttal és karabínerrel. Hosszúság: kb. 180 cm RészletekKLP Lovasfelszerelés
Hevedertok Elasztikus

Hevedertok Elasztikus4 870 Ft

Elasztikus hevedertok, mely sokféle méretű hevederrel használható. Hossza alapállapotban: kb. 70 cm, kinyújtva akár 100 cm RészletekKLP Lovasfelszerelés
Heveder Díjlovas Memóriahabos

Heveder Díjlovas Memóriahabos17 940 Ft

A különlegesen puha és vastag anyag lehetővé teszi a tökéletes mozgás szabadságot. Megakadályozza horzsolódást és a benyomódási foltokat. Rozsdamentes acél csatokkal és D-gyűrűvel közepén. Nem elasztikus. RészletekKLP Lovasfelszerelés
Vízkihúzó Fém, 1 Kezes

Vízkihúzó Fém, 1 Kezes2 660 Ft

Egyik oldalon gumival, műanyag fogóval. Rozsdamentes acél. Méret: 24 cm x 21 cm RészletekKLP Lovasfelszerelés
Fülsapka Légymaszk Orrhálós

Fülsapka Légymaszk Orrhálós10 590 Ft

Prémium légymaszk fül- és orrvédelemmel. Ideális védelem a rovarok ellen. Tökéletesen illeszkedik és egy helyben marad az elasztikus-tépőzáras rögzítésnek köszönhetően. A füleket is fedi. Sörény nyílással készül. RészletekKLP Lovasfelszerelés
Futószárazó Heveder Színes

Futószárazó Heveder Színes9 770 Ft

Futószárazó heveder erős polipropilénből, puha gyapjú béléssel. 13 gyűrűvel melyek egyedi szárcsatlakoztatást tesznek lehetővé. A póni méret hossza: 1,75 - 2,10 m A nagy méret hossza: 2,00 - 2,40 m RészletekKLP Lovasfelszerelés
Szénaháló Nagy

Szénaháló Nagy5 680 Ft

Extra nagy méretű szénaháló, kis nyílásokkal. Méret: kb. 150 x 80 cm, üresen Nyílások mérete: kb. 4,5 x 4,5 cm RészletekKLP Lovasfelszerelés
Hűtőlábvédő (Db)

Hűtőlábvédő (Db)13 040 Ft

Több különálló rekeszből álló hűtőlábvédő. Ezáltal ideálisan illeszkedik és tartja a ló lábát a tépőzár segítségével. Egyszerűen helyezze a hűtőbe vagy fagyasztóba használat előtt (ne fagyassza túl hosszú ideig - különben a rekeszek átfagyhatnak és eltörhetnek!). A rekeszek egyesével nem távolíthatók el. RészletekKLP Lovasfelszerelés
Bőrlyukasztó Extra

Bőrlyukasztó Extra13 860 Ft

Bőrlyukasztó, melynél a fejméret 0,5mm-enként állítható, 2,5mm-től 4,5mm átmérőig. Akár 70%-kal kevesebb erőkifejtés szükséges használatakor, a különleges nyélnek köszönhetően. RészletekKLP Lovasfelszerelés
Lábpánt Balance Ioncserélő

Lábpánt Balance Ioncserélő10 900 Ft

Balance, ioncserélő lábpánt lovaknak. Előfordul, hogy a környezet megzavarja a testben a pozitív és negatív ionok egyensúlyát. Ugyanakkor a ló egészsége és teljesítménye a negatív ionok ellátásán alapszik. A negatív ionok képesek javítani az oxigén-ellátást, erősíteni az immun rendszert és a koncentrációt. A megfelelő mennyiségű negatív ion növeli a ló... RészletekKLP Lovasfelszerelés
Fülvédős Légymaszk Rojtos

Fülvédős Légymaszk Rojtos10 590 Ft

Elsőosztályú fülvédős légymaszk rojtokkal. Tökéletes védelmet nyújt a kellemetlen rovarokkal szemben. Elasztikus betétekkel és tépőzárral. RészletekKLP Lovasfelszerelés
A KLP karácsonyi ajándéka

A KLP karácsonyi ajándéka

A mi karácsonyi ajándékunk az, hogy a webáruházunkban leadott rendeléséhez (2017 december 23. 18 óráig) 10 ezer forintonként 1000 Ft-os vásárlási utalványt adunk.

Levásárlás: az utalvány 2018 január 1-től vásárolható le, webáruházunkban vagy személyesen, minden 10.000 Ft feletti vásárláshoz, és egyéb kedvezményekkel nem vonható össze.

Megnyitott az új budapesti KLP lovasbolt

Megnyitott az új budapesti KLP lovasbolt

Elköltöztünk! De november 6-án megnyitott az új helyen a budapesti KLP Lovasbolt.

 

Hol van az új üzlet?

  • Rétköz utca - Telekes utca sarkán (Rétköz utca 51/e)
  • 800 m-re az Eleven Centertől, hegynek fel, de ugyanabban az utcában, ugyanazon az oldalon
  • a volt szépségszalon helyén

Néhány képet, térképet és a megközelítést segítő információkat a klp.hu-n találhatnak.

Karácsonyig a budapesti és kecskeméti üzletünkben is minden vasárnap is szombati nyitva tartással várjuk önöket, azaz:

 

Budapesti nyitva tartás

  • hétköznap: 10-18 óra között
  • szombatonként, december 23-ig: 9-17 óra között
  • vasárnaponként, december 17-ig: 9-17 óra között
  • december 24., vasárnap: zárva

 

Kecskeméti nyitva tartás

  • hétköznap: 9-17 óra között
  • szombatonként, december 23-ig: 9-13 óra között
  • vasárnaponként, december 17-ig: 9-13 óra között
  • december 24., vasárnap: zárva

Várjuk Önöket!

Tattini téli ruházat

Tattini téli ruházat

Mint mindig, most is egyszerre praktikus és az olasz divatnak megfelelően elegáns modellek alkotják a Tattini téli ruházati kollekcióját, amelyek egymással is remekül párosíthatóak. A puha pufi, strapabíró softshell és meleg polár felsőkkel biztosan fel tud készülni az átmeneti időszakra és később az igazán hideg időre. Ráadásul ezek a termékek most prémium minőségük dacára is igen kedvező áron kerülnek forgalomba.

További hangulatos képeket a termékekről a klp.hu-n találhatnak.

 

A kollekció

 

Dzseki Női Pufi Bolzano Tattini Dzseki Női Pufi Bolzano Tattini

- elképesztően könnyű, puha és kényelmes
- a különlegesen finom, puha műszőr gallér legombolható
- a csuklónál bebújtatható a hüvelykujj egy szűkített lycra rétegbe
- vízlepergető
- csinos, karcsúsított szabás
- a fenéknél kétoldalt felcipzározható, hogy a nyeregben ülve se gyűrődjön fel
- téli terepre egyéb felsőkkel, lovaglás előtt nagy hidegben, istállóba érkezéshez, de utcai viseletnek is egyedi és stílusos

Ára: 36 700 Ft

Termék adatlap

Lovas Felső Aosta Softshell Tattini Lovas Felső Aosta Softshell Tattini

- kiváló hőtartó képességű, visszaveri a saját testhőt, télen is elég komolyabb munkához csak egy pulóverrel
- de egész évben jól kihasználható hűvösebb, szemerkélős időben is
- belül polár réteggel
- ahol a kar összeér a testtel, ott különleges, bolyhosodás mentes anyaggal ellátva
- vízlepergető
- a fenéknél kétoldalt felcipzározható, hogy a nyeregben ülve se gyűrődjön fel
- karcsúsított szabású

Ára: 35 000 Ft

Termék adatlap

Lovas Felső Női Feltre Polár Tattini Lovas Felső Női Feltre Polár Tattini

- a polár finom puhasága és a softshell betétek praktikuma egyesül e modellben
- a kapucni a szélben, pótolja a sapkát, a fület melegít a kobak alatt
- a cipzár a nyaknál egy füllel el van takarva, hogy semmiképpen ne bántsa a nyakon és az állon a bőrt
- a fenéknél kétoldalt felcipzározható, hogy a nyeregben ülve se gyűrődjön fel
- csuklónál szintén felcipzározható, hogy a kesztyűt kényelmesen alá lehessen venni, így lovaglás közben sem fúj be alá a szél
- karcsúsított szabású
- rövid ujjú pólóval egész évben kiválóan kihasználható

Ára: 27 490 Ft

Termék adatlap

Dzseki Bomber Unisex Tamigi Tattini Dzseki Bomber Unisex Tamigi Tattini

Tattini Tamigi klasszikus unisex bomber dzseki, vízlepergető nylonból, meleg, elütő színű kiváló minőségű mikroszálas polár béléssel. Eredeti Tattini logo jelvénnyel díszítve, a derékon, a mandzsettáknál és részben a gallérnál színben harmonizáló bordás kötés kontrasztos csíkkal. Tattini vésésű a cipzárhúzó. Belül a háton cipzár, hogy az utólagos hímzés könnyen elhelyezhető legyen.

Ára: 19 550 Ft

Termék adatlap

Dzseki Bomber Gyerek Avon Tattini Dzseki Bomber Gyerek Avon Tattini

Tattini Avon klasszikus bomber dzseki gyerekeknek, vízlepergető nylonból, elütő színű kiváló minőségű polár béléssel. Tattini jelvénnyel díszítve, a derékon, a mandzsettáknál és részben a gallérnál színben harmonizáló bordás kötés kontrasztos csíkkal. Tattini vésésű a cipzárhúzó. Belül a háton cipzár, hogy az utólagos egyedi hímzés megoldható legyen.

Ára: 17 840 Ft

Termék adatlap

Tattini és Daslö őszi/téli takarók

Tattini és Daslö őszi/téli takarók

Az új kollekció legnagyobb erénye, hogy figyelembe veszi azt a vissza-visszatérő panaszt, miszerint az egész szezonon át hordott takaró kidörzsöli, kikoptatja a ló sörényét, szőrét bizonyos helyeken. Ennek elkerülése érdekében a nyaki- illetve mar részre műszőrt varrtak és piacra dobtak egy takaró alá vehető szügyvédő sztreccs "ruhát" is.

További modellekért és a teljes kollekcióért látogasson el a klp.hu-ra.

 

Istálló takarók

 

Lótakaró Istálló Steppelt Műszőr Nyak Tattini Lótakaró Istálló Steppelt Műszőr Nyak Tattini

Vízszintes steppelés, 420 denes szakadásálló külső nylon anyag, 330 g-os polyfill bélés. Farokvédővel és a nyakat körül ölelő puha szintetikus bárányszőr szegéssel. Magasan kivágott lépéskönnyítő betoldás és elasztikus dupla pánt a szügynél D karikával és karabinerrel a gyors rögzítéshez. Valamint csatolható és tépőzárral védett pánt a pontos méretbeállításhoz. Has alatt a szegéshez színben illő keresztheveder, elasztikus betoldással a T-karabinereknél, szintén elasztikus rugós karabiner a hátsó lábpántoknál. A takaróhoz igény esetén csatolható Tattini emblémával díszített nyakvédő. (külön rendelendő)

Ára: 21 310 Ft
(A készletek gyorsan fogynak, de a legtöbb méret/szín variációban még elérhető.)

Termék adatlap

Lótakaró Istálló Vastag Műszőr Nyak Tattini Lótakaró Istálló Vastag Műszőr Nyak Tattini

Kiváló szabás, puha és ellenálló 600 denes szakadásálló külső nylon anyag, 400 g-os csak alul steppelt polyfill bélés. Farokvédővel és a nyakat körül ölelő puha szintetikus párnázott bárányszőr szegéssel. Lépéskönnyítő betoldás és elasztikus dupla pánt a szügynél D karikával és karabinerrel a gyors rögzítéshez. Valamint csatolható és tépőzárral védett pánt a pontos méretbeállításhoz. Has alatt a szegéshez színben illő keresztheveder, elasztikus betoldással a T-karabinereknél, szintén elasztikus rugós karabiner a hátsó lábpántoknál. A takaróhoz igény esetén csatolható Tattini emblémával díszített nyakvédő. (külön rendelendő)

Ára: 26 380 Ft
(A készletek gyorsan fogynak, de a legtöbb méret/szín variációban még elérhető.)

Termék adatlap

Lótakaró Istálló Steppelt Daslö Lótakaró Istálló Steppelt Daslö

400 denes szakadásálló külső nylon anyag, 150 gr-os bélés, vízszintes steppelés. Elasztikus betétes kereszthevederrel és rugalmas lábpántokkal. Szügynél csatos pántokkal és tépőzárral a pántok között, magas lépésbetéttel, műszőr marpárnával. Átmeneti időszakra, fokozott szőrnövekedés megakadályozására, melegebb istállókba.

Ára: 15 280 Ft

Termék adatlap

 

Karám takaró

 

Lótakaró Karám Vízálló Bélelt Tattini Lótakaró Karám Vízálló Bélelt Tattini

Tattini bélelt légáteresztő és vízálló karámtakaró. 600 D-s anyagból, 200 gr súlyú bélés, nylon szegés, farok takarórésszel, elöl szíjazható, keresztpántos hevederekkel.

Ára: 22 020 Ft
(A készletek gyorsan fogynak, de több méret/szín variációban még elérhető.)

Termék adatlap

 

Polár takarók

 

Lótakaró Polár Daslö Lótakaró Polár Daslö

Polár lótakaró a Daslötől. Csomósodásmentes 250 g-os polár, karabíneres szügypánttal, farokvédővel.

Ára: 6 490 Ft

Termék adatlap

Lótakaró Polár Hosszított Nyakú Tattini Lótakaró Polár Hosszított Nyakú Tattini

Hosszított nyakú polár istállótakaró a Tattinitől.

- séta takaró, puha és meleg "nem-pelyhesedő" polár anyagból
- zsinóros háromszínű szegéssel
- elöl T-horoggal zárható
- Tattini logó díszíti

Ára: 16 990 Ft

Termék adatlap

Limitált Daslö szintetikus nyereg

Korlátozott ideig barna színben is elérhető a közkedvelt többcélú Daslö szintetikus nyereg. Amíg a készlet tart!

Nyereg Többcélú Szintetikus Daslö Cserélhető Marvas Nyereg Többcélú Szintetikus Daslö Cserélhető Marvas

Szintetikus bőrből, hasított műbőr csúszásmentesített üléssel és térdtámaszokkal, rugalmas műanyag vázzal, bivalybőr felrántószíjjal, tépőzáras térdpárnákkal, gyapjú tömésekkel. Rendkívül könnyű és nagyon egyszerű tisztán tartani.

Ára: 64 270 Ft

Termék adatlap

Munkatársat keresünk

Megnyitott az új budapesti KLP üzlet és egyben csapatunk is megújul.

Keressük eltökélt, vagány, gyorsan tanuló, lovas- és kereskedelmi ismerettel rendelkező értékesítő munkatársunkat, aki ügyes kapcsolattartó, gyakorlott bolti eladó és nem retten meg némi pakolástól, csomagolástól sem.

Jelentkezni lehet fényképes önéletrajzzal: info@klp.hu

 

Lovasok.hu Kártya kedvezmények érvényesek!
Kedvezmény mértéke:
Classic kártyára: -5%
Silver kártyára: -10%
Gold kártyára: -10%

Bemutatkozik a KLP Lovasfelszerelés

A KLP Lovasfelszerelés 1988 óta működő vállalkozás. A Tattini, Daslö, Brad Ren's, Natowa, RoFlexs, Soiltex és PegaPlus termékek kizárólagos magyarországi importőre, a Wintec, Bates, Pessoa, Westfield, Loesdau, Sonnenreiter, Mondial, Mustad, Maddox és Equine Speedskip, HKM márkák forgalmazója.



A hatalmas olaszországi Tattini lerakat, a 150 éve alapított manufaktúra, a világ minden tájáról válogatottan összegyűjtött lovasfelszerelések biztos háttérként állnak mögöttünk, hogy a rendszeresen 2 hetente érkező szállítmányok a legfrissebb igényeket is kielégíthessék.

Tattini törzsvásárlói kártyával országszerte üzleteinkben, partnereinknél és a KLP webáruházban leadott rendelésénél is kedvezményre jogosult.
 
Ha még nincsen Tattini törzsváráslói kártyája, igényeljen Ön is a KLP Lovasfelszerelés üzleteiben illetve partnereinknél, vagy e-mailben! A kártyát egy összegű 100 000 Ft-os vásárlás vagy 200 000 Ft-ot meghaladó összvásárlás felett állítjuk ki.

Elérhetőségek:

KLP Lovasfelszerelés Kft.
Web:
www.klp.hu
E-mail: info@klp.hu
Infóvonal: +36 30 949-7868
KLP Lovasfelszerelés - Lovas szakáruház Budapest:
Tel./Fax.: (36) 1 309 5112 - 1118 Budapest (Gazdagrét), Rétköz u. 51/e
Nyitvatartás: H-P: 10-18-ig, Szo: 9-17-ig, V: zárva
 
KLP Lovasbolt - Kecskemét:
Tel./Fax.: (36) 76 320 875 - 6000 Kecskemét, Kisfaludy u. 2/a
Nyitva tartás: H-P: 9-17-ig, Szo:9-13-ig, V: zárva

Kecskeméti lovasboltunk megközelítése:

***

Budapesti raktáráruházunk megközelítése:

  • M1/M7 (M0) sztráda felől a bevásárlóközpontok elhagyása után Gazdagréti kijárat, Budapestre érve az első Y elágazásnál a lámpánál balra, majd a főútvonalon jobbra és a kb 500m-re lévő Mol benzinkút után be kell hajtani az Eleven Center parkolóházába.
  • Budapest felől érkezve nem a sztrádára kell kihajtani a város szélén, hanem Budaörs felé egyenesen tovább, majd az első lámpánál jobbra.
  • A Déli Pályaudvartól a 139-es busszal jöhetnek a tömegközlekedők. A Nagyszeben téri megállónál leszállva az Eleven Center Kaiser's bejáratánál a lifttel közvetlen a P4-re lehet feljönni.
 

KLP Lovasfelszerelés - Lovas szakáruház Budapest

Cím:
1118 Budapest (Gazdagrét), Rétköz u. 51/e
Térkép
Telefonszám:
+36 1 309 5112

Nyitvatartás:

Hétfő:
10:00 - 18:00
Kedd:
10:00 - 18:00
Szerda:
10:00 - 18:00
Csütörtök:
10:00 - 18:00
Péntek:
10:00 - 18:00
Szombat:
9:00 - 17:00
Vasárnap:
zárva
KLP Lovasfelszerelés - Lovas szakáruház Budapest

KLP Lovasbolt - Kecskemét

Cím:
6000 Kecskemét, Kisfaludy u. 2/a
Térkép
Telefonszám:
+36 76 320 875

Nyitvatartás:

Hétfő:
9:00 - 17:00
Kedd:
9:00 - 17:00
Szerda:
9:00 - 17:00
Csütörtök:
9:00 - 17:00
Péntek:
9:00 - 17:00
Szombat:
9:00 - 13:00
Vasárnap:
zárva
KLP Lovasbolt - Kecskemét
Kiválasztott termékek:
    Kinyit